PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG035565t2
Common NameTCM_035565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Trihelix
Protein Properties Length: 560aa    MW: 61018.5 Da    PI: 4.8181
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG035565t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.97.5e-3086170187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW++qe+laL+++r++m+ ++r+++ k+plWeevs+k++e g++rs+k+Ckek+en+ k++k++k+g+ ++++++   +++fdqlea
  Thecc1EG035565t2  86 RWPRQETLALLKIRSDMDVTFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKYHKRTKDGRTGKSDGK--AYRFFDQLEA 170
                       8********************************************************************975555..5*******85 PP

2trihelix25.53.4e-08444479136
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevsk 36 
                       rW+k ev aLi++r++++ +++++  k+plWee+s 
  Thecc1EG035565t2 444 RWPKVEVEALIKLRTSLDAKYQENGPKGPLWEEISV 479
                       8*********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.7E-483145IPR001005SANT/Myb domain
CDDcd122033.30E-2585150No hitNo description
PfamPF138371.9E-1985171No hitNo description
PROSITE profilePS500906.91185143IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MLGCGDTSVS VLGSSSGGGG GDVAAAAAVA TTVSSSGALD GRSEAAANML GSNGNNNNNN  60
NNTNNNSGDD DRGRVDEGDR SFGGNRWPRQ ETLALLKIRS DMDVTFRDAS VKGPLWEEVS  120
RKLAELGYHR SAKKCKEKFE NVYKYHKRTK DGRTGKSDGK AYRFFDQLEA LENISSIQSP  180
AAPPPPSPQL KPQHQTVMPA ANPPSLSHIT IPSTTLASLP QNIVPPNASF TVPSFPSTNP  240
TIQPPPPTTN PTIPSFPNIS ADLMSNSTSS STSSDLELEG RRKRKRKWKD FFERLMKEVI  300
QKQEDMQKKF LEAIEKREHE RLVREDAWRM QEMARINRER EILAQERSIA AAKDAAVMAF  360
LQKLSEQRNP GQAQNNPLPS QQPQPPPQAP PQPVPAVATA APPAATAAPV PAPAPPLLPL  420
PMVNLDVSKT DNGDQSYTPS SSSRWPKVEV EALIKLRTSL DAKYQENGPK GPLWEEISVD  480
NSSNELKPEN SVPLLVRPEQ QWPPPPSEPD DHQHDHATED MESEQNQDED EKDGDDEEED  540
EGGDYEIVAS KPVSMGTGE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1280285RRKRKR
2280286RRKRKRK
3281286RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ0130922e-94JQ013092.1 Gossypium hirsutum trihelix transcription factor (GT7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019483.10.0Duplicated homeodomain-like superfamily protein isoform 2
SwissprotQ391171e-108TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A061FIK20.0A0A061FIK2_THECC; Duplicated homeodomain-like superfamily protein isoform 2
STRINGPOPTR_0005s21410.11e-155(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-93Trihelix family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]